PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0072300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 528aa    MW: 57645.2 Da    PI: 4.6278
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0072300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS184.47.8e-5734652110186
            GRAS  10 eavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIle 104
                     eav+++d + aq+lL++++ +asp+gd  qRla +f+ +L+arla+++ e+y+al+++++s    +  l+a++l+  ++P+ k+sh+  Nq+Il+
  Spipo6G0072300 346 EAVAADDRRTAQELLKQIRSHASPRGDGSQRLAICFADGLEARLAGTGIEMYHALSAKSQS---AAAILKAYHLYLAACPFKKISHFYSNQTILN 437
                     79*****************************************************999998...999**************************** PP

            GRAS 105 avegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                     a+eg++r+Hi+Df+i  G+QWp+L+q L+ Rp+gpp+lRiTg++spe+g   +e++ etg+rL+ +Ae ++vpfe+++++ak+ 
  Spipo6G0072300 438 AAEGSSRLHIVDFGIYFGFQWPCLIQRLSMRPGGPPKLRITGIESPEPGfrPNERVVETGRRLRAYAEMFNVPFEYHPIAAKDS 521
                     ************************************************9*****************************877654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.14311527IPR005202Transcription factor GRAS
PfamPF035142.7E-54346521IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MIDGLTPGDH PCEQGVITNG LKSEGPADFL GQDNLVDLPF FVTAVANGSS IQTPPASASP  60
QGYSPEDSEI FSDIALSYIS EMLMEEEMDD KLCIGQGASA LDAAVGPFFL DVLGEKSLSS  120
SDGFPLHADT SPEDSSGHGA DSVTTSEAHL ERLLFDVGCP HEMGDHPPPT IGAVSAYSPS  180
DSIGDIFAGI GENQRRDQHQ FGSEIEADSY EEIQPAREYR RGLEEASKFL PDQHRMVIDL  240
EASSSPPSYK KEEKDLTPSP GGFVAEVKVE KEEKSSGYSF LESSKTRKNP HRDDFLSLEE  300
ERSTKQSAVY AEDDDVPSEM FDRVLLCPHG RPNDAISALR KVLQSEAVAA DDRRTAQELL  360
KQIRSHASPR GDGSQRLAIC FADGLEARLA GTGIEMYHAL SAKSQSAAAI LKAYHLYLAA  420
CPFKKISHFY SNQTILNAAE GSSRLHIVDF GIYFGFQWPC LIQRLSMRPG GPPKLRITGI  480
ESPEPGFRPN ERVVETGRRL RAYAEMFNVP FEYHPIAAKD SQKQQQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-293395165183GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008799752.11e-135PREDICTED: scarecrow-like protein 9
RefseqXP_008799758.11e-135PREDICTED: scarecrow-like protein 9
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.14e-81GRAS family protein